Description

Tesamorelin & Ipamorelin Research Peptide Blend (8mg)

Price: $99.00 | Ships Today if Ordered by 12 PM PST

Let’s talk straight about this Tesamorelin and Ipamorelin blend. You’re looking at a purpose-built research tool. It’s not a simple single-compound peptide; it’s a stacked formula designed to target two distinct pathways related to growth hormone secretion. Think of it as a more comprehensive approach for laboratory investigation compared to using either compound alone.

Here’s the breakdown of what you’re getting in this 8mg blend:

The Core Components: How They Work

Tesamorelin is a synthetic analog of Growth Hormone-Releasing Hormone (GHRH). Its structure is a 44-amino acid chain, but it’s been engineered for stability. It has an acetyl group at the N-terminus and a trans-3-hexenoic acid modification at the C-terminus. This design helps it resist degradation, aiming for a more consistent interaction with GHRH receptors in the pituitary. The goal of this interaction is to stimulate the synthesis and release of endogenous growth hormone (hGH). One study noted it may induce a 69% rise in overall GH levels (AUC) and a 55% increase in average pulse area.

Ipamorelin operates on a different channel. It’s a selective growth hormone secretagogue (GHS) that targets the ghrelin receptor. Its sequence is Aib-His-D-2Nal-D-Phe-Lys. Its selectivity is a key point—research suggests it doesn’t significantly spike cortisol or ACTH, which can be a concern with some non-secretagogues. By activating the GHS receptor pathway, it may trigger a rapid release of stored growth hormone. Data indicates it can support secretion levels exceeding 80 mIU/l, which is a significant increase over baseline.

Research Applications & Observed Data

This blend is for in-vitro study only. The following summarizes published research on the individual compounds to inform your experimental direction.

On Adipose (Fat) Tissue

Research paths have shown divergent effects, which makes this blend interesting for comparative study. Tesamorelin has been associated with a reduction of visceral fat by approximately 25% in certain models, particularly those simulating lipodystrophy. It appears to target deep abdominal fat stores. Ipamorelin, while also elevating GH, has been linked to increased appetite signaling via ghrelin receptors, potentially leading to weight gain in some models—one study noted around a 15% increase in weight. This contrast is worth noting for metabolic research.

On Musculoskeletal Tissue

Studies on Tesamorelin have used CT scans to measure changes. Findings suggest potential improvements in muscle density and area, specifically in muscles like the psoas major and rectus abdominis. The changes were statistically significant compared to control groups. Ipamorelin has been studied in catabolic stress models, where it appeared to help reduce excessive nitrogen loss by about 20% and rebalance urea cycle activity, suggesting a potential role in preserving lean mass under stress.

On Bone Mineral Density

Murine studies on Ipamorelin suggest potential anabolic effects on bone. Research points to possible increases in bone mineral content (BMC) and bone formation. One important note from the data: the increase in BMC may be due to increased bone dimensions (growth), while volumetric density might remain unchanged. This is a key distinction for research analysis.

On Gastric Emptying

Given Ipamorelin’s action on the ghrelin receptor, which regulates hunger and digestion, studies have looked at gastric function. In models with slowed gastric emptying, Ipamorelin exposure was associated with a quicker return to normal emptying rates compared to controls. It also appeared to help maintain gastric smooth muscle contractility under experimental stress.

Key Specifications for Your Lab Records

• Blend: Tesamorelin & Ipamorelin
• Total Quantity: 8mg
• Tesamorelin Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
• Ipamorelin Sequence: Aib-His-D-2Nal-D-Phe-Lys
• Tesamorelin Mol. Formula: C221H366N72O67S
• Ipamorelin Mol. Formula: C38H49N9O5
• Tesamorelin Mol. Weight: 5136 g/mol
• Ipamorelin Mol. Weight: 711.868 g/mol

Why Source This Blend From Us?

We don’t deal in hype. We deal in specifics. This blend is prepared under strict controls, and every batch is independently verified for purity and content. You get exactly what the label says: a precise blend of Tesamorelin and Ipamorelin for controlled laboratory use. We ship in stable, temperature-conscious packaging and get it out the door the same day if your order is in by noon PST. That’s the standard.